Pairwise Alignments
Query, 137 a.a., Hypothetical protein YaeJ with similarity to translation release factor from Pseudomonas fluorescens FW300-N1B4
Subject, 361 a.a., peptide chain release factor 1 (RefSeq) from Shewanella loihica PV-4
Score = 40.4 bits (93), Expect = 3e-08 Identities = 29/104 (27%), Positives = 48/104 (46%), Gaps = 25/104 (24%) Query: 8 VHLPDAEIELTAIRAQGAGGQNVNKVSSAMHLRFDIPASSLPEFYKERLLALRDSRITSE 67 + + A++++ RA GAGGQ+VNK SA+ + IP+ Sbjct: 217 IEINPADLKVDTFRASGAGGQHVNKTDSAIRIT-HIPSG--------------------- 254 Query: 68 GVLIIKAQQYRTQEANRADALERLTELILSATKVEKKRRPTKPT 111 ++++ Q R+Q NRA A+ L I A + EK+R + T Sbjct: 255 --IVVECQDQRSQHKNRAQAMSVLAARI-QAVEDEKRRSEEEST 295