Pairwise Alignments
Query, 207 a.a., putative haloacid dehalogenase-like hydrolase (NCBI ptt file) from Bacteroides thetaiotaomicron VPI-5482
Subject, 205 a.a., haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED/haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E from Sphingomonas koreensis DSMZ 15582
Score = 42.7 bits (99), Expect = 5e-09 Identities = 21/54 (38%), Positives = 30/54 (55%) Query: 136 DYFEKTYLSYEMKMAKPEPEIFKAVTEDAGIDPKETFFIDDSEINCKVAQELGI 189 D F +S + K+ KP+P I+ G++P E FIDD+E N A+ LGI Sbjct: 129 DRFRDIVVSGDEKLVKPDPAIYHLSLARFGLEPHEAVFIDDNEANILSARALGI 182