Pairwise Alignments
Query, 110 a.a., N-terminal part of the catalytic subunit of an oxidoreductase like aldehyde oxidase or xanthine dehydrogenase from Sinorhizobium meliloti 1021
Subject, 739 a.a., aldehyde oxidase from Pontibacter actiniarum KMM 6156, DSM 19842
Score = 43.9 bits (102), Expect = 4e-09 Identities = 24/50 (48%), Positives = 31/50 (62%), Gaps = 1/50 (2%) Query: 50 IGRPVDRVDGPVKVTGTATYAYEVAEGPPSAFGFVLGAGIAKGRILEIET 99 IG+ +RVDG KVTG A YA E A GFV+ + IA+G+I I+T Sbjct: 6 IGKATNRVDGRAKVTGEAKYAAEF-NADNMAHGFVVSSAIARGKIKSIDT 54