Pairwise Alignments
Query, 72 a.a., DUF2633 family protein from Rahnella sp. WP5
Subject, 63 a.a., Negative regulator of nickel and cobalt uptake (YfgG) (from data) from Escherichia coli BW25113
Score = 58.5 bits (140), Expect = 9e-15 Identities = 25/45 (55%), Positives = 35/45 (77%) Query: 6 NIRMTKIVLAISFIILFGRLVYSAIGAYSHHQNQKQTRPDTQTVE 50 N RMT+IVL ISFI FGR +YS++GA+ HHQ++K+ + T +VE Sbjct: 14 NSRMTRIVLLISFIFFFGRFIYSSVGAWQHHQSKKEAQQSTLSVE 58