Pairwise Alignments
Query, 712 a.a., Predicted ATP-dependent endonuclease of the OLD family from Enterobacter asburiae PDN3
Subject, 363 a.a., DNA replication and repair protein RecF from Vibrio cholerae E7946 ATCC 55056
Score = 43.1 bits (100), Expect = 2e-08 Identities = 20/46 (43%), Positives = 30/46 (65%) Query: 1 MHISKLTLVNYRNFKNTSLQFHKGVNTVIGENGSGKSNILRAIRLL 46 M +S+L + +RN K ++ G N +IG NGSGK+++L AI LL Sbjct: 1 MPLSRLMIQQFRNIKACDIRLSAGFNFLIGPNGSGKTSVLEAIYLL 46