Pairwise Alignments
Query, 712 a.a., Predicted ATP-dependent endonuclease of the OLD family from Enterobacter asburiae PDN3
Subject, 360 a.a., DNA replication and repair protein RecF (RefSeq) from Shewanella loihica PV-4
Score = 43.9 bits (102), Expect = 1e-08 Identities = 20/46 (43%), Positives = 31/46 (67%) Query: 1 MHISKLTLVNYRNFKNTSLQFHKGVNTVIGENGSGKSNILRAIRLL 46 M +S+L + ++RN + LQ G+N + G+NGSGK++IL AI L Sbjct: 1 MSLSRLHIDSFRNIASAQLQLGDGLNLIYGQNGSGKTSILEAIFFL 46