Protein Info for Xcc-8004.892.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Coupling protein VirD4, ATPase required for T-DNA transfer

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 PF02534: T4SS-DNA_transf" amino acids 62 to 394 (333 residues), 233 bits, see alignment E=1e-72 PF10412: TrwB_AAD_bind" amino acids 142 to 355 (214 residues), 73.6 bits, see alignment E=2.3e-24 PF12696: TraG-D_C" amino acids 238 to 355 (118 residues), 98 bits, see alignment E=6.2e-32

Best Hits

KEGG orthology group: K03205, type IV secretion system protein VirD4 (inferred from 100% identity to xcc:XCC3462)

Predicted SEED Role

"Coupling protein VirD4, ATPase required for T-DNA transfer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>Xcc-8004.892.1 Coupling protein VirD4, ATPase required for T-DNA transfer (Xanthomonas campestris pv. campestris strain 8004)
MPQRALVPDVTARAHRNRTLATRIQRGPTQESNRRHDPGCLCPTSGKHRYHQPRTLNQAA
TQGGGTSDAQKFWVSQARNAFMAFTLYLFDSLDDQIKREHPKDTWMFPTLGMLYRVSSGD
GSDLKGYLKKLSQRDFLGRDAKTAFDNLLSQAEETFASIMGTFKEPLNQFINPILDASTS
DNDFLLTDVRKKKMSIYIGIQPNKLAESRLLINLLFSQLINLNTKELPQNNPVLEHQCLL
LMDEFTSIGRVDIIASAVSYMAGYNIRLLPIIQSMAQLDATYGKDVSRTIITNHALQIVY
APREQQDANDYSDMLGYTTVRKKNKSQTSGKQSSVSYSETEQRRALMLPQELKAMGFDKE
VFLYEGIPSPVLCEKIKYYEDAYFTKRLLPKAEVKALMSTAAW