Protein Info for Xcc-8004.880.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Rod shape-determining protein MreB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 TIGR00904: cell shape determining protein, MreB/Mrl family" amino acids 9 to 340 (332 residues), 530.6 bits, see alignment E=7e-164 PF06723: MreB_Mbl" amino acids 11 to 339 (329 residues), 501 bits, see alignment E=3.1e-154 PF00022: Actin" amino acids 36 to 206 (171 residues), 33.6 bits, see alignment E=4.5e-12 PF00012: HSP70" amino acids 102 to 208 (107 residues), 50.8 bits, see alignment E=2.1e-17 PF14450: FtsA" amino acids 163 to 320 (158 residues), 53.3 bits, see alignment E=8.9e-18

Best Hits

Swiss-Prot: 77% identical to MREB_ECOLI: Cell shape-determining protein MreB (mreB) from Escherichia coli (strain K12)

KEGG orthology group: K03569, rod shape-determining protein MreB and related proteins (inferred from 100% identity to xcb:XC_0691)

Predicted SEED Role

"Rod shape-determining protein MreB" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X486 at UniProt or InterPro

Protein Sequence (348 amino acids)

>Xcc-8004.880.1 Rod shape-determining protein MreB (Xanthomonas campestris pv. campestris strain 8004)
MFKKLRGMFSNDLSIDLGTANTLIYVRGQGIVLNEPSVVAVRQDRAIGGTRSVAAVGAEA
KQMLGRTPGHITTIRPMKDGVIADFTYTEAMLKHFIKKVHKSRFLRPSPRVLVCVPAGST
QVERRAIKESAEEAGARDVYLIEEPMAAAIGAGMPVTEARGSMVIDIGGGTTEVAVISLN
GIVYSQSVRVGGDRFDESITNYVRRNHGMLIGEATAERIKLQIGCAYPQDEVQEMEISGR
NLAEGVPKMIKINSNEVLEALHEPLSGIVSAVKLALEQTPPELCADVAERGIVLTGGGAL
LRDLDRLISEETGLHVQVADDPHTCVARGGGRALELVDMHGNEFFAPE