Protein Info for Xcc-8004.866.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Methanol dehydrogenase large subunit protein (EC 1.1.99.8)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 579 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR03075: PQQ-dependent dehydrogenase, methanol/ethanol family" amino acids 55 to 573 (519 residues), 557.6 bits, see alignment E=1.4e-171 PF13360: PQQ_2" amino acids 140 to 254 (115 residues), 48.7 bits, see alignment E=1.2e-16 amino acids 512 to 574 (63 residues), 20.7 bits, see alignment E=4.3e-08 PF13570: PQQ_3" amino acids 142 to 192 (51 residues), 18.9 bits, see alignment 2.6e-07 amino acids 522 to 562 (41 residues), 30.1 bits, see alignment 7.3e-11 PF01011: PQQ" amino acids 174 to 207 (34 residues), 31.5 bits, see alignment (E = 1.5e-11) amino acids 544 to 574 (31 residues), 24.6 bits, see alignment (E = 2.3e-09)

Best Hits

KEGG orthology group: None (inferred from 100% identity to xcc:XCC3482)

Predicted SEED Role

"Methanol dehydrogenase large subunit protein (EC 1.1.99.8)" in subsystem Respiratory dehydrogenases 1 (EC 1.1.99.8)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.99.8

Use Curated BLAST to search for 1.1.99.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X3Z4 at UniProt or InterPro

Protein Sequence (579 amino acids)

>Xcc-8004.866.1 Methanol dehydrogenase large subunit protein (EC 1.1.99.8) (Xanthomonas campestris pv. campestris strain 8004)
MHQSSCRSARGGVLLMLALSAVLAGCKKDTPAEPAAPAQTAAPAAAAPAAAVVDTDGEFT
TNASNPDNWGGVGRDFALTRHSPLAEINRDNVKNLKMSWEMKTDATRGHEGQPLVIGSIM
YMVSAYPNNVYAIDLASQDDGGKVLWKYTPQQDERSVAVACCDTVNRGASYADGKLVFGS
LSGDVIALDAKTGKEVWKQKLGHPDKGETITMAPIIADGKVIAGISGNEFGVLGRVAAYN
LADGKQAWSCDAAGTDKSICLGADFNKANPQHGQLGDLGVKTFPNDEWKRGGGAAWGWYS
YDPKLKLLYYGTGNPGLWSPSYRCGKTSHEECNNGEHDNKWSMTLFARKIDTGEAVWGYQ
KTPFDQWDYDGINEPILVDLTIDGKEVPSVVQFDRNGFAYVLDRRDGTLLRAHKFVPANW
AERIDMKTGRPVKVAAHSPLERGKKVQAFPSAMGGKDQQPCSVDPANSAVFFCGTNNWHM
ELEPQERGNTMMGLPYVFANVMMKPNEPGALGIVKAFDVVEGKSKWEIKEKFPVWSGTLV
TDGGLVFYGTLDGWFRAVDKDTGKKLWEMKLPSDTPRVS