Protein Info for Xcc-8004.624.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Cyclic AMP receptor protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 PF00027: cNMP_binding" amino acids 36 to 124 (89 residues), 73.4 bits, see alignment E=1.8e-24 PF13545: HTH_Crp_2" amino acids 163 to 225 (63 residues), 42.1 bits, see alignment E=9.9e-15 PF00325: Crp" amino acids 186 to 217 (32 residues), 52.2 bits, see alignment 5.8e-18

Best Hits

Swiss-Prot: 100% identical to CLP_XANCB: CRP-like protein Clp (clp) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K10914, CRP/FNR family transcriptional regulator, cyclic AMP receptor protein (inferred from 100% identity to xcb:XC_0486)

Predicted SEED Role

"Cyclic AMP receptor protein" in subsystem CytR regulation or cAMP signaling in bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4UZF6 at UniProt or InterPro

Protein Sequence (230 amino acids)

>Xcc-8004.624.1 Cyclic AMP receptor protein (Xanthomonas campestris pv. campestris strain 8004)
MSLGNTTVVTTTVRNATPSLTLDAGTIERFLAHSHRRRYPTRTDVFRPGDPAGTLYYVIS
GSVSIIAEEDDDRELVLGYFGSGEFVGEMGLFIESDTREVILRTRTQCELAEISYERLQQ
LFQTSLSPDAPRILYAIGVQLSKRLLDTTRKASRLAFLDVTDRIVRTLHDLSKEPEAMSH
PQGTQLRVSRQELARLVGCSREMAGRVLKKLQADGLLHARGKTVVLYGTR