Protein Info for Xcc-8004.4965.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Methionine ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 PF00005: ABC_tran" amino acids 24 to 172 (149 residues), 127.8 bits, see alignment E=4.7e-41

Best Hits

Swiss-Prot: 48% identical to Y352_THEMA: Uncharacterized ABC transporter ATP-binding protein TM_0352 (TM_0352) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: K02003, (no description) (inferred from 100% identity to xca:xccb100_4100)

MetaCyc: 43% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XC67 at UniProt or InterPro

Protein Sequence (229 amino acids)

>Xcc-8004.4965.1 Methionine ABC transporter ATP-binding protein (Xanthomonas campestris pv. campestris strain 8004)
MTALVTLRNITKTYQRGPEKVQVLHGIDMEIARGDFVAMMGPSGSGKTTLLNLIGGLDTP
SGGEIEIEGERIDRMSGGQLATWRSHHVGFVFQFYNLMPMLTAQKNVELPLLLTSLNAAQ
RKRNAEIALTLVGLQERRNHKPSELSGGQQQRVAIARAIVSDPTFLICDEPTGDLDRHNA
EEILRLLQELNREHGKTIVMVTHDPKAAEYATHTIHLDKGELADAPLAL