Protein Info for Xcc-8004.4953.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Putative FMN hydrolase (EC 3.1.3.-); 5-Amino-6-(5'-phosphoribitylamino)uracil phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 PF00702: Hydrolase" amino acids 5 to 193 (189 residues), 73.9 bits, see alignment E=3.6e-24 PF13419: HAD_2" amino acids 67 to 198 (132 residues), 42.1 bits, see alignment E=1.6e-14 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 81 to 199 (119 residues), 32.4 bits, see alignment E=9.5e-12 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 89 to 193 (105 residues), 44.8 bits, see alignment E=1.8e-15 PF13242: Hydrolase_like" amino acids 155 to 221 (67 residues), 39.5 bits, see alignment E=6.4e-14

Best Hits

KEGG orthology group: K07025, putative hydrolase of the HAD superfamily (inferred from 100% identity to xcb:XC_3991)

Predicted SEED Role

"Putative FMN hydrolase (EC 3.1.3.-); 5-Amino-6-(5'-phosphoribitylamino)uracil phosphatase" (EC 3.1.3.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-

Use Curated BLAST to search for 3.1.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XDT5 at UniProt or InterPro

Protein Sequence (243 amino acids)

>Xcc-8004.4953.1 Putative FMN hydrolase (EC 3.1.3.-); 5-Amino-6-(5'-phosphoribitylamino)uracil phosphatase (Xanthomonas campestris pv. campestris strain 8004)
MSFQISAITIDLDDTLWPFAPIGARIDQVLYDWMREHSPVTAARFPVEAMRELRERSFAD
NPHLHHDLSALRRLTLEMALRDSGGDLALLEPAYEVFYAARNQVECYPDALDALARIAAH
VPVAALSNGNADLERIGLMHHFAFQLGSREHGSAKPDPSIFLAACARLQAPPAQVLHVGD
HVRMDVLGALDAGLRACWINREQAQWSHPTQQPDLEFDSLTGLADWLDVHHTPAAHAGVC
VPG