Protein Info for Xcc-8004.4940.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: PF00070 family, FAD-dependent NAD(P)-disulphide oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 PF07992: Pyr_redox_2" amino acids 6 to 322 (317 residues), 206.3 bits, see alignment E=3.1e-64 PF01134: GIDA" amino acids 7 to 120 (114 residues), 23.1 bits, see alignment E=1.6e-08 PF00890: FAD_binding_2" amino acids 7 to 37 (31 residues), 21.8 bits, see alignment (E = 4.6e-08) PF01266: DAO" amino acids 7 to 123 (117 residues), 30.5 bits, see alignment E=1.3e-10 PF00070: Pyr_redox" amino acids 173 to 249 (77 residues), 68.6 bits, see alignment E=2.5e-22 PF02852: Pyr_redox_dim" amino acids 346 to 451 (106 residues), 79.2 bits, see alignment E=1.2e-25

Best Hits

KEGG orthology group: K00520, mercuric reductase [EC: 1.16.1.1] (inferred from 100% identity to xca:xccb100_4081)

Predicted SEED Role

"PF00070 family, FAD-dependent NAD(P)-disulphide oxidoreductase" in subsystem Mercuric reductase

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.16.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XBR7 at UniProt or InterPro

Protein Sequence (460 amino acids)

>Xcc-8004.4940.1 PF00070 family, FAD-dependent NAD(P)-disulphide oxidoreductase (Xanthomonas campestris pv. campestris strain 8004)
MTATRYDAIVVGAGQAGPSLAVRLAERGQRVAVIERHLVGGTCVNTGCMPTKTLVASARV
AHLARRAGDYGVRIAGPVEVDLPQVMARAHAISDAARTGVEQWLAQTPGVQLIRGHARFV
APDRLRVGAQELGAPRIFLNVGGRARTPELPGLDQISPLNNTSILQLRTLPQHLVVIGGS
YIGLEFAQIFRRLGAQVTVVEQHAHLIGREDADISEAIAQMLQDEGIAVRTDARCIAFAA
HADGAAVQLECAQGAPQIVASHVLLALGRQPNTDDLGLEAAGIATDAQGYVQVDMQLATN
VPGVWAMGDCNGRGAFTHTAYNDYEILAANLLDGAERRLSQRVPAYALFTDPPLGRVGMS
ETQARASGRPLLVAQRPMQQVGRARENGETIGMMKLVADAQTRRVLGAAILGLHGDEAIH
GIIDLINADQPIDTLEWAVPIHPTVSELWPTLARALAPAQ