Protein Info for Xcc-8004.4910.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Spermidine synthase (EC 2.5.1.16)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17284: Spermine_synt_N
  • amino acids 7 to 58 (52 residues), 42.5 bits, 4.8e-15
• TIGR00417: spermidine synthase
  • amino acids 7 to 278 (272 residues), 270.8 bits, E=5.7e-85
• PF01564: Spermine_synth
  • amino acids 63 to 246 (184 residues), 193.6 bits, E=2.5e-61

Best Hits

Swiss-Prot: 100% identical to SPEE_XANC8: Polyamine aminopropyltransferase (speE) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K00797, spermidine synthase [EC: 2.5.1.16] (inferred from 100% identity to xcb:XC_3954)

MetaCyc: 37% identical to spermidine synthase (Saccharomyces cerevisiae)
Spermidine synthase. [EC: 2.5.1.16]

Predicted SEED Role

"Spermidine synthase (EC 2.5.1.16)" in subsystem Polyamine Metabolism (EC 2.5.1.16)

MetaCyc Pathways

• L-methionine salvage cycle III (9/11 steps found)
• spermidine biosynthesis I (2/2 steps found)
• superpathway of polyamine biosynthesis II (6/8 steps found)
• superpathway of arginine and polyamine biosynthesis (12/17 steps found)
• L-methionine salvage cycle I (bacteria and plants) (8/12 steps found)
• superpathway of polyamine biosynthesis I (4/8 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Glutathione metabolism
• Methionine metabolism
• Urea cycle and metabolism of amino groups
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.16

Use Curated BLAST to search for 2.5.1.16

Sequence Analysis Tools

See Q4UPN0 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Xcc-8004.4910.1 Spermidine synthase (EC 2.5.1.16) (Xanthomonas campestris pv. campestris strain 8004)
MSTNDNWYIEHFQPTGSAIGYRISGKLDEVQSPFQKIEIYQTTDWGKLMIIDGAVMLTSR
DNFFYHEMISHPALFTHAAPKRVVIIGGGDCGTLREVLKHPGVESATQCDIDEQVTRMSE
KYFPELCDSNDDARAELLFDDGVAYMANCPAGSVDIVIVDSTDPVGPAEGLFNKSFYESC
FKALKDDGILVQQSESPLALLDLIKEMRTEMGKAGFQSFKTLPFPQPCYPTGWWSVTMAS
KQANADFAFRQADAQAKGFDTLYYTAHLHTGVLVAPPFVAKALGE