Protein Info for Xcc-8004.4910.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Spermidine synthase (EC 2.5.1.16)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF17284: Spermine_synt_N" amino acids 7 to 58 (52 residues), 42.5 bits, see alignment 4.8e-15 TIGR00417: spermidine synthase" amino acids 7 to 278 (272 residues), 270.8 bits, see alignment E=5.7e-85 PF01564: Spermine_synth" amino acids 63 to 246 (184 residues), 193.6 bits, see alignment E=2.5e-61

Best Hits

Swiss-Prot: 100% identical to SPEE_XANC8: Polyamine aminopropyltransferase (speE) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K00797, spermidine synthase [EC: 2.5.1.16] (inferred from 100% identity to xcb:XC_3954)

MetaCyc: 37% identical to spermidine synthase (Saccharomyces cerevisiae)
Spermidine synthase. [EC: 2.5.1.16]

Predicted SEED Role

"Spermidine synthase (EC 2.5.1.16)" in subsystem Polyamine Metabolism (EC 2.5.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.16

Use Curated BLAST to search for 2.5.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4UPN0 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Xcc-8004.4910.1 Spermidine synthase (EC 2.5.1.16) (Xanthomonas campestris pv. campestris strain 8004)
MSTNDNWYIEHFQPTGSAIGYRISGKLDEVQSPFQKIEIYQTTDWGKLMIIDGAVMLTSR
DNFFYHEMISHPALFTHAAPKRVVIIGGGDCGTLREVLKHPGVESATQCDIDEQVTRMSE
KYFPELCDSNDDARAELLFDDGVAYMANCPAGSVDIVIVDSTDPVGPAEGLFNKSFYESC
FKALKDDGILVQQSESPLALLDLIKEMRTEMGKAGFQSFKTLPFPQPCYPTGWWSVTMAS
KQANADFAFRQADAQAKGFDTLYYTAHLHTGVLVAPPFVAKALGE