Protein Info for Xcc-8004.4904.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: O-antigen acetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 40 to 61 (22 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 235 to 253 (19 residues), see Phobius details amino acids 259 to 282 (24 residues), see Phobius details amino acids 292 to 309 (18 residues), see Phobius details amino acids 329 to 350 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 4 to 346 (343 residues), 82.8 bits, see alignment E=1.2e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to xcb:XC_3949)

Predicted SEED Role

"O-antigen acetylase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XC22 at UniProt or InterPro

Protein Sequence (374 amino acids)

>Xcc-8004.4904.1 O-antigen acetylase (Xanthomonas campestris pv. campestris strain 8004)
MRYPALDLLRGIAIVWVMLFHAFVVGGLGPEWAWLSRYGWMGVDLFFVLSGFLIGTQVLM
PLASGQRLDFTDFYLRRAFRILPAFLVVLAVYLAWPGFRESPGLAPWWMFVTFTLNLLVD
YGRDAAFSHAWSLCVEEHFYLLFPLLATVLLRRPSALRFGVLCVAVVVAGIALRAGVWLH
DSALDAAGAGLQRNWFIEDIYYPTWNRLDCLLAGVVLAVVKVFRPHTWQRLQQRGNAFAL
AGVAVMALALWLFRDRTGLLGNAVGWPVLSLGLACLVLAGTATNSALGRLRVPGAAWLAC
ISYSLYLTHKAVFHVTQTWLGAALDGRGILAFAVYGVCALLAGALLHYAVERPFLRLRGR
VLRRRSSAVVAEPA