Protein Info for Xcc-8004.4791.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Probable Co/Zn/Cd efflux system membrane fusion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 50 to 377 (328 residues), 278.5 bits, see alignment E=3e-87 PF16576: HlyD_D23" amino acids 74 to 295 (222 residues), 66.4 bits, see alignment E=3.4e-22 PF13533: Biotin_lipoyl_2" amino acids 75 to 118 (44 residues), 42.7 bits, see alignment 5.9e-15 PF13437: HlyD_3" amino acids 186 to 280 (95 residues), 26.3 bits, see alignment E=1.6e-09

Best Hits

Swiss-Prot: 39% identical to MDTA_DICZ5: Multidrug resistance protein MdtA (mdtA) from Dickeya zeae (strain Ech586)

KEGG orthology group: None (inferred from 100% identity to xcc:XCC3787)

MetaCyc: 40% identical to multidrug efflux pump membrane fusion protein MdtA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-353; TRANS-RXN-92

Predicted SEED Role

"Probable Co/Zn/Cd efflux system membrane fusion protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XBU1 at UniProt or InterPro

Protein Sequence (412 amino acids)

>Xcc-8004.4791.1 Probable Co/Zn/Cd efflux system membrane fusion protein (Xanthomonas campestris pv. campestris strain 8004)
MSRFWKISLLVVAVLVVVFVAMRMMGGGQQGKRPGAPDGNGTENSGPVPVTVVPAATQDV
PVYATALGTVTALNTVTVNPQVSGQLMSLNFQEGQEVKKGALLAQIDPRTLQASYDQALA
AKRQNQALLATARVNYQRSNDPAYKQYVSRTDLDTQRNQVAQYEAAVAANDAQMRSAQVQ
LQFTRVTAPIDGIAGIRGVDVGNIVSTTSTIVTLTQIRPIYVSFSLPERELPAVRSGQAA
TPLPVAALDRGDAHVISADGKLDVIDNRIAADSGTFGARAIFGNADNALWPGQFVNVRLQ
LRTISGGTVVPTQAVQRGPDGDYVYVVGSDSTAQMRTVVQGVEVDDSHVQITKGLKPGER
VVTEGQFRLKPGSKVSALKPGETPPEPTEAELKAAQDKSRGSAGGRRGGGPR