Protein Info for Xcc-8004.4756.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: FIG01211576: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 TIGR00229: PAS domain S-box protein" amino acids 12 to 126 (115 residues), 55.2 bits, see alignment E=7.5e-19 amino acids 142 to 253 (112 residues), 27.7 bits, see alignment E=2.5e-10 PF00989: PAS" amino acids 13 to 123 (111 residues), 47.2 bits, see alignment E=6.3e-16 amino acids 143 to 212 (70 residues), 24 bits, see alignment E=1e-08 PF08448: PAS_4" amino acids 22 to 125 (104 residues), 50.3 bits, see alignment E=7.9e-17 amino acids 149 to 248 (100 residues), 50.3 bits, see alignment E=7.7e-17 PF13426: PAS_9" amino acids 23 to 125 (103 residues), 46.7 bits, see alignment E=9.9e-16 amino acids 151 to 248 (98 residues), 21.9 bits, see alignment E=5.2e-08 PF08447: PAS_3" amino acids 35 to 119 (85 residues), 42.7 bits, see alignment E=1.6e-14 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 281 to 449 (169 residues), 168.5 bits, see alignment E=1e-53 PF00990: GGDEF" amino acids 283 to 446 (164 residues), 157.7 bits, see alignment E=6.7e-50

Best Hits

KEGG orthology group: None (inferred from 100% identity to xcc:XCC3759)

Predicted SEED Role

"FIG01211576: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XBD1 at UniProt or InterPro

Protein Sequence (452 amino acids)

>Xcc-8004.4756.1 FIG01211576: hypothetical protein (Xanthomonas campestris pv. campestris strain 8004)
VADAPMPQHPLAHLHDIVHDNSDWIWEVDAQARYTFCSRACERLLGYTPEQILGRTPFDL
MEPAEAARVGVAFAEIVAARRPFQGLLNRNVRADGRTVMLETSGIPLFDAQGALRGYRGI
DRDVTPIAGGPDDSATNQRLFQLEALYAAAPVALCLINHAARYLAVNEAMAGIAGRSVQE
MIGMRVAEVFPQAAADQADAFATLAAGHDVPDQVFDWQDRSYHVRVRGVRDLEGRLIALT
TALTDISEHLRVQWRLTKTTEALAEANRQLEQANAQLLGAARNDHLTGLANRRGFDRAFE
RLLPAVRDGTRGASVLMLDVDYFKQYNDRYGHPQGDQCLRDIAAALRSVVTRGEDVVARY
GGEEFALLLPDTDLPGAAEVARRLQERLAAMPISHAGSPCARITVSIGVTALQPQECQVQ
DARVREAVMARADRALYQAKNQGRNRVALAPV