Protein Info for Xcc-8004.4602.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Methionine ABC transporter permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 34 to 56 (23 residues), see Phobius details amino acids 67 to 91 (25 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 161 to 183 (23 residues), see Phobius details amino acids 203 to 222 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 56 to 231 (176 residues), 76.2 bits, see alignment E=1.4e-25

Best Hits

Swiss-Prot: 50% identical to METI_ECOLI: D-methionine transport system permease protein MetI (metI) from Escherichia coli (strain K12)

KEGG orthology group: K02072, D-methionine transport system permease protein (inferred from 100% identity to xcc:XCC3629)

MetaCyc: 50% identical to L-methionine/D-methionine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
RXN0-4522 [EC: 7.4.2.11]; 7.4.2.11 [EC: 7.4.2.11]; TRANS-RXN-383 [EC: 7.4.2.11]; TRANS-RXN0-510 [EC: 7.4.2.11]; TRANS-RXN0-511 [EC: 7.4.2.11]

Predicted SEED Role

"Methionine ABC transporter permease protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XCZ6 at UniProt or InterPro

Protein Sequence (232 amino acids)

>Xcc-8004.4602.1 Methionine ABC transporter permease protein (Xanthomonas campestris pv. campestris strain 8004)
MNLLPIAAAPGFFRNLDAAKWGDIGQATLDTLLMLAGALPLTLLIGLPLGVALFLCGAPQ
LRRRPVLYGALAAVINLLRSVPFIILMIAMIPLTLMLMGTSLGVRGAILPLVVGAAPFYA
RLVETALREVDRGIIEASQAMGATTRQLVWRVLLPEARPGLIAGATVTTIALIGFTAMGG
AIGSGGLGDVAYREGYLRSHSDVALITVIALLVLVQLLQMLGDRLVARYSRR