Protein Info for Xcc-8004.4455.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 PF13302: Acetyltransf_3" amino acids 12 to 128 (117 residues), 27.2 bits, see alignment E=1.7e-09 TIGR01575: ribosomal-protein-alanine acetyltransferase" amino acids 19 to 150 (132 residues), 142 bits, see alignment E=6e-46 PF00583: Acetyltransf_1" amino acids 21 to 128 (108 residues), 67.4 bits, see alignment E=4.1e-22 PF13480: Acetyltransf_6" amino acids 29 to 107 (79 residues), 30 bits, see alignment E=1.6e-10 PF13673: Acetyltransf_10" amino acids 40 to 133 (94 residues), 48.7 bits, see alignment E=2.3e-16 PF13508: Acetyltransf_7" amino acids 51 to 129 (79 residues), 49.6 bits, see alignment E=1.3e-16 PF08445: FR47" amino acids 71 to 131 (61 residues), 29.1 bits, see alignment E=2.5e-10

Best Hits

KEGG orthology group: K03789, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 100% identity to xcb:XC_3592)

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.128

Use Curated BLAST to search for 2.3.1.- or 2.3.1.128

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XCR1 at UniProt or InterPro

Protein Sequence (160 amino acids)

>Xcc-8004.4455.1 Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-) (Xanthomonas campestris pv. campestris strain 8004)
VSAMNAPMPTALRAMRESDLDAVMDIERRAYPFPWTRSIFRDCLQAGYPGWVLEQAGQII
GYGVISIAADEAHVLNVCIAPEAQSQGHGRVLLRALIKAACDRGARRAFLEVRPSNPSAI
ALYHSEGFNEIGRRPRYYPAHTGREDALVMAIELFFEGIS