Protein Info for Xcc-8004.4242.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: LSU rRNA 2'-O-methyl-C2498 methyltransferase RlmM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 PF18125: RlmM_FDX" amino acids 1 to 68 (68 residues), 90.8 bits, see alignment E=9.7e-30 PF21239: RLMM_N" amino acids 81 to 158 (78 residues), 68.4 bits, see alignment E=7.2e-23 PF01728: FtsJ" amino acids 182 to 275 (94 residues), 37.7 bits, see alignment E=3.1e-13

Best Hits

Swiss-Prot: 100% identical to RLMM_XANC8: Ribosomal RNA large subunit methyltransferase M (rlmM) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K06968, ribosomal RNA large subunit methyltransferase M [EC: 2.1.1.-] (inferred from 100% identity to xcc:XCC0816)

Predicted SEED Role

"LSU rRNA 2'-O-methyl-C2498 methyltransferase RlmM"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4UR65 at UniProt or InterPro

Protein Sequence (347 amino acids)

>Xcc-8004.4242.1 LSU rRNA 2'-O-methyl-C2498 methyltransferase RlmM (Xanthomonas campestris pv. campestris strain 8004)
MSGLLCYCRQGFEPELAAELSARAAFVGIAGYARTQRNDGYVLFVCDEAAQLAARLQWRE
LIFARQKLVVLAELKGLDPKDRITPILAALDGQPRFGDLWVEHPDSDAGKPLAGLARSFG
NALRPALRKAGLLTDKPQARLPRLHICFLDGDHALLAVADSSDSAPWPLGIPRLKLLPEA
PSRSALKLDEALLTLLTPEEREQLVKPGMRAADLGAAPGGWTWVLTRQHVHVTSVDNGPL
REHVLATGLVEHLRADGFHWKPAQPLDWMVCDMVEQPRRVAERMATWVREGWCRHTIFNL
KLPMKKRWDETRLCLDLFEQQAEKSLTVRAKQLYHDREEITVLAMRG