Protein Info for Xcc-8004.4112.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Periplasmic thiol:disulfide oxidoreductase DsbB, required for DsbA reoxidation

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 172 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 42 to 60 (19 residues), see Phobius details amino acids 72 to 92 (21 residues), see Phobius details amino acids 144 to 163 (20 residues), see Phobius details PF02600: DsbB" amino acids 9 to 160 (152 residues), 155.4 bits, see alignment E=7.3e-50

Best Hits

Swiss-Prot: 100% identical to DSBB_XANC8: Disulfide bond formation protein B (dsbB) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K03611, disulfide bond formation protein DsbB (inferred from 100% identity to xcc:XCC0921)

Predicted SEED Role

"Periplasmic thiol:disulfide oxidoreductase DsbB, required for DsbA reoxidation" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4URG5 at UniProt or InterPro

Protein Sequence (172 amino acids)

>Xcc-8004.4112.1 Periplasmic thiol:disulfide oxidoreductase DsbB, required for DsbA reoxidation (Xanthomonas campestris pv. campestris strain 8004)
MNPFRWGFRAQFLLGFLACAGLLAYAIYVQLHLGLEPCPLCIFQRIAFATLALLFLLGAL
HGPRGAGGRKAYGVLAFIAAGVGMGIAARHVWVQIRPKDMMSSCGPPLSFLSETMGPFEV
FRTVLTGTGDCGNIDWRFLGLSMPMWSMVWFVGLALWALYAGFKHRGPRKLF