Protein Info for Xcc-8004.4022.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Molybdenum cofactor biosynthesis protein MoaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 TIGR02666: molybdenum cofactor biosynthesis protein A" amino acids 14 to 343 (330 residues), 349 bits, see alignment E=1.2e-108 PF04055: Radical_SAM" amino acids 28 to 191 (164 residues), 96.6 bits, see alignment E=2.8e-31 PF13353: Fer4_12" amino acids 30 to 101 (72 residues), 23.2 bits, see alignment E=1.1e-08 PF06463: Mob_synth_C" amino acids 200 to 323 (124 residues), 124.2 bits, see alignment E=4.9e-40

Best Hits

Swiss-Prot: 100% identical to MOAA_XANC8: GTP 3',8-cyclase (moaA) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K03639, molybdenum cofactor biosynthesis protein (inferred from 100% identity to xca:xccb100_3364)

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaA" in subsystem Molybdenum cofactor biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4URN0 at UniProt or InterPro

Protein Sequence (343 amino acids)

>Xcc-8004.4022.1 Molybdenum cofactor biosynthesis protein MoaA (Xanthomonas campestris pv. campestris strain 8004)
MGALMLPDLSAAPMQDRYGRPLRDLRLSVIEACNFRCGYCMPADRVPDDYGLDADQRLSF
DQLETLVRAFVAVGVTKLRLTGGEPLLRKNLPVLIQRLAAIEGIEDLALTTNGALLARQA
VALRQAGLRRITVSMDALEPALFRQMSGGRGEIDQVLAGIAAAEQAGFKRLKINCVVQRD
VNEDQVLPLVEHFRGTGHVLRFIEFMDVGSCNGWRPEAVVTSAQLRDRIHARWPLAPLDA
NYTGEVAQRHAFADGLGEVGFVSSVSVPFCGDCQRARVSADGHLYTCLFASQGHDLKPAL
AEGEQGLATHLRQRWSVRADRYSEVRASTSRRRKPVEMFLIGG