Protein Info for Xcc-8004.4.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: DNA recombination and repair protein RecF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 210 to 224 (15 residues), see Phobius details PF13514: AAA_27" amino acids 1 to 92 (92 residues), 24.2 bits, see alignment E=4.8e-09 TIGR00611: DNA replication and repair protein RecF" amino acids 1 to 359 (359 residues), 256.3 bits, see alignment E=2.5e-80 PF02463: SMC_N" amino acids 3 to 339 (337 residues), 71.7 bits, see alignment E=1.2e-23 PF13476: AAA_23" amino acids 5 to 59 (55 residues), 40.6 bits, see alignment 8.9e-14

Best Hits

Swiss-Prot: 100% identical to RECF_XANCP: DNA replication and repair protein RecF (recF) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K03629, DNA replication and repair protein RecF (inferred from 100% identity to xcc:XCC0003)

Predicted SEED Role

"DNA recombination and repair protein RecF" in subsystem DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4V0S6 at UniProt or InterPro

Protein Sequence (368 amino acids)

>Xcc-8004.4.1 DNA recombination and repair protein RecF (Xanthomonas campestris pv. campestris strain 8004)
MHVARLSIHRLRRFEAVEFHPASTLNLLTGDNGAGKTSVLEALHVMAYGRSFRGRVRDGL
IRQGGQDLEIFVEWRERAGDSTERTRRAGLRHSGQEWTGRLDGEDVAQLGSLCAALAVVT
FEPGSHVLISGGGEPRRRFLDWGLFHVEPDFLALWRRYARALKQRNALLKQGAQPQMLDA
WDHELAESGETLTSRRLQYLERLQERLVPVATAIAPSLGLSALTFAPGWRRHEVSLADAL
LLARERDRQNGYTSQGPHRADWAPLFDALPGKDALSRGQAKLTALACLLAQAEDFAHERG
EWPIMALDDLGSELDRHHQARVIQRLASAPAQVLITATELPPGLADAGKTLRRFHVEHGQ
LVPTTAAD