Protein Info for Xcc-8004.395.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Formyltetrahydrofolate deformylase (EC 3.5.1.10)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 PF01842: ACT" amino acids 11 to 71 (61 residues), 33 bits, see alignment E=6.1e-12 PF13740: ACT_6" amino acids 12 to 85 (74 residues), 25 bits, see alignment E=2.2e-09 TIGR00655: formyltetrahydrofolate deformylase" amino acids 12 to 288 (277 residues), 334.5 bits, see alignment E=3.1e-104 PF00551: Formyl_trans_N" amino acids 94 to 270 (177 residues), 143.9 bits, see alignment E=7.2e-46

Best Hits

Swiss-Prot: 53% identical to PURU_CORS1: Formyltetrahydrofolate deformylase (purU) from Corynebacterium sp. (strain P-1)

KEGG orthology group: K01433, formyltetrahydrofolate deformylase [EC: 3.5.1.10] (inferred from 100% identity to xcb:XC_0322)

Predicted SEED Role

"Formyltetrahydrofolate deformylase (EC 3.5.1.10)" in subsystem One-carbon metabolism by tetrahydropterines (EC 3.5.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X3C0 at UniProt or InterPro

Protein Sequence (289 amino acids)

>Xcc-8004.395.1 Formyltetrahydrofolate deformylase (EC 3.5.1.10) (Xanthomonas campestris pv. campestris strain 8004)
LAIISPMRSDYILTLSCPDRTGIVYRVTGLLFDLACNILDAQQFGDDESGRFFLRVHFDK
PPRTDIAQLEQQFSQLAAGFEMTWQLHDARRRARLLVLVSKQGHCLNDLLFRMHSRQLPV
DIVAVVSNHTDFAPLAASYGIAFHHLPVSADTRAEQETQLLALVERLQVDLVVLARYMQI
LSPALCRALAGRAINIHHSFLPSFKGAQPYHQAHARGVKIIGATAHYVTEDLDEGPIIEQ
DVARVDHAMTPRDLVRLGSDTESLVLARAVRRHVEHRIVLNGHRTVVFR