Protein Info for Xcc-8004.384.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Deoxyribonuclease TatD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01026: TatD_DNase
  • amino acids 4 to 260 (257 residues), 260.2 bits, E=9.6e-82

Best Hits

Swiss-Prot: 52% identical to TATD_ERWT9: 3'-5' ssDNA/RNA exonuclease TatD (tatD) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K03424, TatD DNase family protein [EC: 3.1.21.-] (inferred from 100% identity to xca:xccb100_0325)

MetaCyc: 50% identical to 3' -> 5' ssDNA/RNA exonuclease TatD (Escherichia coli K-12 substr. MG1655)
3.1.13.-; Exodeoxyribonuclease I. [EC: 3.1.11.1]

Predicted SEED Role

"Deoxyribonuclease TatD" in subsystem Twin-arginine translocation system or YcfH

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.1, 3.1.21.-

Use Curated BLAST to search for 3.1.11.1 or 3.1.21.-

Sequence Analysis Tools

See A0A0H2X3B1 at UniProt or InterPro

Protein Sequence (268 amino acids)

>Xcc-8004.384.1 Deoxyribonuclease TatD (Xanthomonas campestris pv. campestris strain 8004)
MQLIDIGANLTHDSFDRDRDAVLQRARDAGVAQLVITGASREHSPLALQLAQQHPGFLYA
TAGVHPHHAVEFTAECEREMRALQAQPQVVAVGECGLDYYRDFAPRPAQHKAFERQLQLA
ADNGKPLFLHQRDAHDDFLSIMRAFDGRLGAAVVHCFTGTREELFDYLDRDYYIGITGWL
CDERRGAHLRELVRNIPANRLMIETDAPYLLPRTLKPLPKERRNEPMFLSHIVEELARDR
GEDVAVTAENSTAAARAFFRLPVPATAA