Protein Info for Xcc-8004.3831.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: 4-hydroxybenzoyl-CoA thioesterase (EC 3.1.2.23)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K07107, acyl-CoA thioester hydrolase [EC: 3.1.2.-] (inferred from 99% identity to xca:xccb100_3191)

Predicted SEED Role

"4-hydroxybenzoyl-CoA thioesterase (EC 3.1.2.23)" (EC 3.1.2.23)

MetaCyc Pathways

4-hydroxybenzoate biosynthesis III (plants) (4/5 steps found)
4-chlorobenzoate degradation (2/4 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.- or 3.1.2.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XBH8 at UniProt or InterPro

Protein Sequence (134 amino acids)

>Xcc-8004.3831.1 4-hydroxybenzoyl-CoA thioesterase (EC 3.1.2.23) (Xanthomonas campestris pv. campestris strain 8004)
MSEHKILARVPISVRWRDMDSMGHVNNAKYISYLEEARVRWMLGVEGVAMTDRIAPVVAA
TNVNYKRPLVWPNDILVELFVERLGSSSVTIGHRILDQKDEGVLYSDGNVVVVWIDTQTG
KSASLPDAVRAASS