Protein Info for Xcc-8004.3721.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Type III secretion inner membrane protein (YscT,HrcT,SpaR,EscT,EpaR1,homologous to flagellar export components)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 51 to 66 (16 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 135 to 158 (24 residues), see Phobius details amino acids 195 to 217 (23 residues), see Phobius details amino acids 229 to 248 (20 residues), see Phobius details TIGR01401: type III secretion apparatus protein SpaR/YscT/HrcT" amino acids 13 to 264 (252 residues), 261.6 bits, see alignment E=3.7e-82 PF01311: Bac_export_1" amino acids 20 to 251 (232 residues), 168.5 bits, see alignment E=9.4e-54

Best Hits

KEGG orthology group: K03228, type III secretion protein SctT (inferred from 100% identity to xca:xccb100_3067)

Predicted SEED Role

"Type III secretion inner membrane protein (YscT,HrcT,SpaR,EscT,EpaR1,homologous to flagellar export components)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2XBB2 at UniProt or InterPro

Protein Sequence (276 amino acids)

>Xcc-8004.3721.1 Type III secretion inner membrane protein (YscT,HrcT,SpaR,EscT,EpaR1,homologous to flagellar export components) (Xanthomonas campestris pv. campestris strain 8004)
MSDTATALLALSSQGVSLLTLLALCGVRVFVLFFVLPATAQDSLPGMTRNGVIYVLSSFI
AYGQPADALARIEAAGLVGLVFKEAFIGLLIGFAASTVFWVAESVGLLIDDVSGYNNVQM
INPLSGEQSTPVSTVLMQLAIVSFYALGGMLMLLGALFESFRWWPLSQLMPDMGAIGESF
VIQQTDGMMAAIVKLSAPVMLVLVLVDLAIGFVARAADKLDPSNLSQPIRGVLALLLLAL
LTSVFIAQSGDALGFLHFQQQLHDAANASAKGGASH