Protein Info for Xcc-8004.3669.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: 23S rRNA (Uracil-5-) -methyltransferase RumA (EC 2.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 PF01938: TRAM" amino acids 17 to 52 (36 residues), 22.7 bits, see alignment 3.7e-08 TIGR00479: 23S rRNA (uracil-5-)-methyltransferase RumA" amino acids 264 to 436 (173 residues), 190.2 bits, see alignment E=2.9e-60 PF05958: tRNA_U5-meth_tr" amino acids 274 to 443 (170 residues), 84 bits, see alignment E=5.5e-27 PF00398: RrnaAD" amino acids 282 to 353 (72 residues), 28.3 bits, see alignment E=4.8e-10 PF01135: PCMT" amino acids 282 to 356 (75 residues), 29.4 bits, see alignment E=3.5e-10 PF05175: MTS" amino acids 292 to 376 (85 residues), 29.8 bits, see alignment E=2.3e-10 PF01189: Methyltr_RsmB-F" amino acids 292 to 383 (92 residues), 27.3 bits, see alignment E=1.3e-09 PF13847: Methyltransf_31" amino acids 296 to 374 (79 residues), 49.4 bits, see alignment E=2e-16 PF03602: Cons_hypoth95" amino acids 298 to 376 (79 residues), 24.6 bits, see alignment E=9e-09 PF13649: Methyltransf_25" amino acids 301 to 356 (56 residues), 35.6 bits, see alignment 6.1e-12 PF08241: Methyltransf_11" amino acids 302 to 356 (55 residues), 23.4 bits, see alignment 3.9e-08

Best Hits

Swiss-Prot: 100% identical to RLMD_XANC8: 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD (rlmD) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K03215, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 100% identity to xcb:XC_2964)

Predicted SEED Role

"23S rRNA (Uracil-5-) -methyltransferase RumA (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4USG1 at UniProt or InterPro

Protein Sequence (444 amino acids)

>Xcc-8004.3669.1 23S rRNA (Uracil-5-) -methyltransferase RumA (EC 2.1.1.-) (Xanthomonas campestris pv. campestris strain 8004)
VARSRNRFDRTPFQTAITDLSHDGRGVARRDGEGGKVTFISGALPGEVVVAEPTARSRHF
DEAKTVEVLQASPQRVAPRCPHFGVCAGCVLQHLEESQQIVAKQRVLMDNLERIGHVTPQ
TVLPALVGDTWGYRRKGRFSVRRVEKKDKTLVGFRELDPRFVADLSVCYTVIPQIGEKIP
QLAALVEGMDGKRDIPQIEFIAGDDAVALTIRHLQPLSARDEQALVEFAQAHDFAIFLQP
GGVDSVHPLWPQEVPLSFRLPKWDVELAFRPLDFIQVNASLNQKMIAHALALLDAKPDDR
VLDLFCGLGNFTLPLARTVREVVGVEGDAGLVARARENAQRNGLDNAQFYAADLTQDQRQ
TAWMRQGFDKLLLDPPRSGAIDVLQQLPLKQFKRIVYVSCHPGSLARDAGYLVNEQGFSL
LSAGAMDMFPHTAHVESIAVFEKR