Protein Info for Xcc-8004.364.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 TIGR01879: amidase, hydantoinase/carbamoylase family" amino acids 33 to 412 (380 residues), 374 bits, see alignment E=4.3e-116 PF04389: Peptidase_M28" amino acids 70 to 146 (77 residues), 25 bits, see alignment E=2.2e-09 PF01546: Peptidase_M20" amino acids 87 to 415 (329 residues), 87.3 bits, see alignment E=2e-28 PF07687: M20_dimer" amino acids 225 to 319 (95 residues), 28.8 bits, see alignment E=1.5e-10

Best Hits

KEGG orthology group: K02083, allantoate deiminase [EC: 3.5.3.9] (inferred from 100% identity to xcb:XC_0294)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X4G3 at UniProt or InterPro

Protein Sequence (423 amino acids)

>Xcc-8004.364.1 hypothetical protein (Xanthomonas campestris pv. campestris strain 8004)
MLSAVASNAPVASGARAVARCDALGVAPFSDTPTGLFRSWLSPAHRATTEQVGAWMRQAG
MQVRLDAAANLVGRYEGAHAHAPALLIGSHLDSVRAAGRYDGPLGVLLGIECVAALHAQG
RRLPFAIEVVGFGDEEGSRFPASMFCSRAVAGTLDAAALAVRDPDGVDVATALAAWGLDA
ARLHEAARVPGSVLAYLETHIEQGPVLEVAQLPVGIVTGIAAQRRFRLRFDGRAGHAGTT
TMALRRDALSAAAEALLMIEQIARSGGDDLVATVGKLEVAPGAINVVPGRVDCTLDVRAG
DDHRRDAAVAQIERALEQVVAARGVAIAVEPLQALAASPCAPALIARLTQAVAAQGITPR
PLVSGAGHDAMVMAALCPTAMLFVRCAGGISHHPDEHVDPADAEVALAVMRHFIEHFGAP
IGT