Protein Info for Xcc-8004.3524.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Inner membrane component of tripartite multidrug resistance system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 526 transmembrane" amino acids 23 to 42 (20 residues), see Phobius details amino acids 65 to 86 (22 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 124 to 145 (22 residues), see Phobius details amino acids 153 to 175 (23 residues), see Phobius details amino acids 181 to 203 (23 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 288 to 308 (21 residues), see Phobius details amino acids 315 to 337 (23 residues), see Phobius details amino acids 347 to 366 (20 residues), see Phobius details amino acids 376 to 399 (24 residues), see Phobius details amino acids 413 to 434 (22 residues), see Phobius details amino acids 491 to 509 (19 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 29 to 507 (479 residues), 516.1 bits, see alignment E=4.6e-159 PF07690: MFS_1" amino acids 33 to 427 (395 residues), 185.3 bits, see alignment E=2.3e-58 PF00083: Sugar_tr" amino acids 37 to 194 (158 residues), 37.7 bits, see alignment E=1.9e-13 PF06609: TRI12" amino acids 38 to 307 (270 residues), 46.6 bits, see alignment E=2.9e-16

Best Hits

Swiss-Prot: 48% identical to EMRB_ECO57: Multidrug export protein EmrB (emrB) from Escherichia coli O157:H7

KEGG orthology group: K03446, MFS transporter, DHA2 family, multidrug resistance protein B (inferred from 100% identity to xca:xccb100_2897)

MetaCyc: 48% identical to multidrug efflux pump membrane subunit EmrB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-363; TRANS-RXN-364; TRANS-RXN-365

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X998 at UniProt or InterPro

Protein Sequence (526 amino acids)

>Xcc-8004.3524.1 Inner membrane component of tripartite multidrug resistance system (Xanthomonas campestris pv. campestris strain 8004)
MSSQAPTAPGGPSAPAPAAGFRPASVALCTVGLAMASFMQVLDTTIANVSLPTIAGNLGA
SSQQATWVITSFAVSTAIALPLTGWLSRRFGETKLFVWSTLAFTIASLLCGLAQSMGMLV
VARALQGFVAGPMYPITQSLLVSIYPREKRGQALALLAMITVVAPIAGPILGGWITDNYS
WEWIFLINVPLGIIASSIVGSQLRHRPEQLERPRMDYIGLILLVVGVGALQLVLDLGNDE
DWFSSDKIVVLACVAAVALVVFVIWELTDKDPIVDLKLFRHRNFRAGTLAMVVAYAAFFS
VSLLIPQWLQRDMGYTAIWAGLATAPIGILPVLMTPFVGKYALRFDLRMLATIAFIFMSF
TSFFRSNFNLQVDFAHVATIQLVMGVGVALFFMPVLQILLSDLDGREIAAGSGLATFLRT
LGGSFAASLTTYLWARRTQVHHAHITEHISVYTPGMQEQVTAMGQGDLQRGAASLNNMIN
HQASQMGFNDIFYLLGWTFLGIIFFLWLAKPPFGAGAGGAAAAGGH