Protein Info for Xcc-8004.3354.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Sulfate transporter family protein in cluster with carbonic anhydrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 transmembrane" amino acids 19 to 39 (21 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 120 to 140 (21 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 247 to 269 (23 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 328 to 359 (32 residues), see Phobius details amino acids 378 to 406 (29 residues), see Phobius details PF00916: Sulfate_transp" amino acids 16 to 383 (368 residues), 196.5 bits, see alignment E=6e-62

Best Hits

KEGG orthology group: None (inferred from 100% identity to xcb:XC_2703)

Predicted SEED Role

"Sulfate transporter family protein in cluster with carbonic anhydrase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X8L5 at UniProt or InterPro

Protein Sequence (519 amino acids)

>Xcc-8004.3354.1 Sulfate transporter family protein in cluster with carbonic anhydrase (Xanthomonas campestris pv. campestris strain 8004)
MNTAGIGGYFRQGLFGRDLLASVVVFLVALPLCMGIAIASGMPPATGLITGIIGGLVVGF
LAGSPLQVSGPAAGLAVLVFELVREHGAAALGPVILVAGAIQLVAGLCRAGVWFRMTSPA
VVAGMLSGIGILIVASQAHVLMDAAPKARGLENFAALPAVLWQAISEGTGRTALLVGLAT
IGIILAWDKLRPQRLRFLPGALIAVVVVTATVQLQGLNVNKVDVPTNLFSAISIPRLSDI
FGVFNHTLLVSAVTFAFIASAETLLSAAAVDRMHQGARTQYDRELAAQGVGNMLCGFLGA
LPMTGVIVRSAANVQAGAATRVSTILHGSWLLVFAMLLPWLLRMTPVACLAGILVYTGVK
MIKIGQVKELATYGRGTAAIYLATTFAIVATDLLTGVLIGFGLSLFRLALHSSRLKVEVR
EHADKKDEMHLTLQGSATFLKVPAMARTLESVPPNTVLHLDVAKLHHVDHACIELLRDWS
RNAASRGCELAVDWNELDRRVEGQRKVDPVPTQEPRKAA