Protein Info for Xcc-8004.3335.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: 23S rRNA (guanine-N-2-) -methyltransferase rlmL EC 2.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 711 PF02926: THUMP" amino acids 30 to 152 (123 residues), 43.2 bits, see alignment E=2e-14 PF01170: UPF0020" amino acids 161 to 372 (212 residues), 138.4 bits, see alignment E=1.2e-43 PF10672: Methyltrans_SAM" amino acids 489 to 663 (175 residues), 57.7 bits, see alignment E=4.9e-19 PF03602: Cons_hypoth95" amino acids 545 to 633 (89 residues), 35 bits, see alignment E=5.4e-12 PF05175: MTS" amino acids 545 to 668 (124 residues), 24.4 bits, see alignment E=9.2e-09

Best Hits

Swiss-Prot: 100% identical to RLMKL_XANC8: Ribosomal RNA large subunit methyltransferase K/L (rlmL) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K12297, ribosomal RNA large subunit methyltransferase L [EC: 2.1.1.173] (inferred from 100% identity to xcc:XCC1545)

Predicted SEED Role

"23S rRNA (guanine-N-2-) -methyltransferase rlmL EC 2.1.1.-)"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.173

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4UT85 at UniProt or InterPro

Protein Sequence (711 amino acids)

>Xcc-8004.3335.1 23S rRNA (guanine-N-2-) -methyltransferase rlmL EC 2.1.1.-) (Xanthomonas campestris pv. campestris strain 8004)
VKFFASCAKGLEYLLADELLALGASKATATISGVNVEGALRDAQRAVLWSRLASRVLWPL
TEFDCPDEDALYAGVAELPWHEHLSTGHTLSVDAHVSGTAITHARYAAQRIKDAVVDTIR
RQGLERPSVDVESPDLRLNLSLRKGRATISVDLGGGPLHRRGWRMAQNEAPLKENLAAAV
LLRAGWPRAYADGGGLLDPMCGSGTLLIEGALMAADVAPGLQRYGSDIPSRWRGFDRDSW
QQLVTEARERDSVGRAALKQVIHGSDMDPHAIRAAKENAQVAGVAEAIWFGVREVGDLQT
RPQATGVVVCNPPYDERLAADAALYRKLGDTLQRVVPQWRASLLCGNAELAYATGLRAGK
KYQLFNGAIECALIVCDPIAVPRRTPLAAPTALSEGAQMVANRLRKNLQKFKKWRAREGI
ECFRVYDADLPEYSAAIDVYQQADGDRRIFLHVQEYAAPATIPEADVRRRLGELLAAARE
VFEVPAERVALKSRERGKGGSKYGRFEQRNEIVNVREHGALLRVNLFDYLDTGLFLDHRP
LRGTMAQQSKGRRFLNLFCYTGVASVQAAVAGASATTSVDLSGTYLQWCADNLALNGQAG
SKHKLVQADALAWLEAERAHFDVIFCDPPTFSNSARAEDFDIQREHVRLLRAAVARLAPG
GVLYFSNNFRRFKLDEEAVSEFAQCEEISPRTIDPDFERHARIHRAWRLTA