Protein Info for Xcc-8004.3163.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Radical SAM domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 589 PF04055: Radical_SAM" amino acids 310 to 465 (156 residues), 50.4 bits, see alignment E=1.5e-17

Best Hits

KEGG orthology group: K04034, anaerobic magnesium-protoporphyrin IX monomethyl ester cyclase [EC: 4.-.-.-] (inferred from 100% identity to xca:xccb100_2577)

Predicted SEED Role

"Radical SAM domain protein"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X8K5 at UniProt or InterPro

Protein Sequence (589 amino acids)

>Xcc-8004.3163.1 Radical SAM domain protein (Xanthomonas campestris pv. campestris strain 8004)
VRALRPQRADWRQFRHCGRLRHAVSSVHKFSRCVRLGRRKVACIARRAHERRAAHGSCIG
TTKVACMRTYCRAECRCLARAAAAPTWRQNENLAQMLKIQVSHSYFLRYDPKQWERGKPY
PPLATLQVAALLREHGHRLSLFDAMLADDVQDYPGALQAAQPDLVVFYEDNFNFLTKMCL
SRMREAACTMIATARAQGCRVLVAGSDASDNPDVFLAAGADAVLIDEGIAPLLELVARLD
ANPQCAPDTWLDGVARIATAHPAAAREHVGAQPPDARLGGLPAWDLVDIPRYRTFWQQRH
GYFSLNMAASRGCPFRCNWCAKPIWGNHYKRRSAEDVAAEMIHLKRTFGPDHIWMADDIF
GFHIDWVETFAEQLSDADGAIPFMIQTRADLASDRMATALARAGCAEAWLGAESGSQRIL
DKMTKGTQVADVIAARRRLGARGIRVGFFIQLGYLGEELVDILATRALVREAAPDLIGVS
VSYPLPGTKFYEEVKNQLGGKTHWQDSDDLAMMFRGAYDSEFYRSVRNLLHTEVDLQQAR
TTMGDLAYAQAWQALEQRWDSLIASEHAHRTEPLTAARPVRQLASVLVG