Protein Info for Xcc-8004.2915.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF01113: DapB_N" amino acids 1 to 104 (104 residues), 67.7 bits, see alignment E=1e-22 PF05173: DapB_C" amino acids 107 to 220 (114 residues), 115.6 bits, see alignment E=1.7e-37

Best Hits

Swiss-Prot: 100% identical to DAPB_XANCB: 4-hydroxy-tetrahydrodipicolinate reductase (dapB) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K00215, dihydrodipicolinate reductase [EC: 1.3.1.26] (inferred from 100% identity to xca:xccb100_2128)

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8)" (EC 1.17.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.8 or 1.3.1.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4UU71 at UniProt or InterPro

Protein Sequence (222 amino acids)

>Xcc-8004.2915.1 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8) (Xanthomonas campestris pv. campestris strain 8004)
MGKALLRLAAEDDALHVVGAVVGRSPSQRVVDGVPYFAANELGGAPAFDVAIDFSLPQGF
APILALCVQRGKPLVSGTTGLDEAQRAGLLQAAGQIPLVWASNFSLGVAVLTELVERAAG
SLPGWDCDIIEAHHVHKQDAPSGTALTLGEAATGSGAQPRFASVRAGDIVGEHSVQFTGL
GERVELIHRATNRDIFARGALHAAKRLLGKPPGSYRVRDLVL