Protein Info for Xcc-8004.2754.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: ATP-dependent Clp protease ATP-binding subunit ClpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 760 TIGR02639: ATP-dependent Clp protease ATP-binding subunit ClpA" amino acids 3 to 737 (735 residues), 1073.1 bits, see alignment E=0 PF02861: Clp_N" amino acids 13 to 62 (50 residues), 47.4 bits, see alignment 1.1e-15 PF00004: AAA" amino acids 214 to 327 (114 residues), 45.9 bits, see alignment E=4.6e-15 amino acids 495 to 610 (116 residues), 38.4 bits, see alignment E=9.9e-13 PF17871: AAA_lid_9" amino acids 355 to 455 (101 residues), 93.6 bits, see alignment E=4e-30 PF07724: AAA_2" amino acids 489 to 650 (162 residues), 195.5 bits, see alignment E=4.2e-61 PF07728: AAA_5" amino acids 494 to 612 (119 residues), 44.4 bits, see alignment E=1e-14 PF10431: ClpB_D2-small" amino acids 656 to 736 (81 residues), 84.6 bits, see alignment E=2.4e-27

Best Hits

Swiss-Prot: 63% identical to CLPA_ECO57: ATP-dependent Clp protease ATP-binding subunit ClpA (clpA) from Escherichia coli O157:H7

KEGG orthology group: K03694, ATP-dependent Clp protease ATP-binding subunit ClpA (inferred from 100% identity to xcb:XC_2218)

MetaCyc: 63% identical to ATP-dependent Clp protease ATP-binding subunit ClpA (Escherichia coli K-12 substr. MG1655)
Endopeptidase Clp. [EC: 3.4.21.92]

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpA" in subsystem Proteolysis in bacteria, ATP-dependent

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.92

Use Curated BLAST to search for 3.4.21.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X9C4 at UniProt or InterPro

Protein Sequence (760 amino acids)

>Xcc-8004.2754.1 ATP-dependent Clp protease ATP-binding subunit ClpA (Xanthomonas campestris pv. campestris strain 8004)
MFSKDLEQTIGQCYKRAREARHEFMTVEHLLLSLLDNPSAQAVLKACGADQVRLHTDLEQ
AIEASVSRLAEDDGRDTQPTLGFQRVLQRAVYHVQSSGKKEVTGANVLVAIFGEKDSHAV
YFLNQQDITRLDIVNYLSHGIAKLGEDGEQPSASDGEPKSDAGEGEGKGDALAEYATNLN
DHARNGKIDPLVGRADEIERTIQVLCRRRKNNPLYVGEAGVGKTAIAEGLAKRIVDADVP
EVLADAVIFSLDLGALVAGTKYRGDFEKRLKGVLTALKKVPNAVLFIDEIHTIIGAGSAS
GGTMDASNLIKPALASGELRCIGSTTFQEYRGIFEKDRALARRFQKIDIVEPTVGETFEI
LQGLKPKYEAHHGVTYADDALQAAVDLSVKHIGDRLLPDKAIDVIDEAGARQRLLPEGQR
KELIDIQEIETIVAKMARIPAKQVSATDKDVLQHLERNLKMVIFGQNPAIETLAGSIKLA
RSGLANPEKPIGNFLFAGPTGVGKTEVTKQLALQLGIELVRFDMSEYMEAHSISRLIGAP
PGYVGFDQGGLLTEKIVKTPHCVLLLDEVEKAHPDIFNILLQVMDRGILTDTNGREANFK
NVILVMTTNAGATQASRRSIGFTKQDHSTDAMESIRRGFTPEFRNRLDAIVQFQPLGFDH
ILRVVDKFIIELEMLLQEKHVSLSATPTARDWLAQHGFDPLMGARPMSRVIQEKIKRPLA
DELLFGKLVEGGRVNIDVKDGELVVEAHPEPERLLPATVD