Protein Info for Xcc-8004.2733.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Outer membrane protein YfgL, lipoprotein component of the protein assembly complex (forms a complex with YaeT, YfiO, and NlpB)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR03300: outer membrane assembly lipoprotein YfgL" amino acids 8 to 402 (395 residues), 439.9 bits, see alignment E=3.1e-136 PF13570: PQQ_3" amino acids 58 to 99 (42 residues), 18.4 bits, see alignment 3.6e-07 amino acids 150 to 189 (40 residues), 31.6 bits, see alignment 2.5e-11 PF13360: PQQ_2" amino acids 58 to 107 (50 residues), 23 bits, see alignment 8.4e-09 amino acids 118 to 330 (213 residues), 160.3 bits, see alignment E=9.3e-51 amino acids 314 to 401 (88 residues), 30.8 bits, see alignment E=3.5e-11 PF01011: PQQ" amino acids 81 to 109 (29 residues), 23.7 bits, see alignment (E = 4.7e-09) amino acids 131 to 167 (37 residues), 21.1 bits, see alignment 3e-08 amino acids 173 to 204 (32 residues), 26.8 bits, see alignment (E = 4.7e-10)

Best Hits

Swiss-Prot: 100% identical to BAMB_XANCP: Outer membrane protein assembly factor BamB (bamB) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: None (inferred from 100% identity to xcb:XC_2198)

Predicted SEED Role

"Outer membrane protein YfgL, lipoprotein component of the protein assembly complex (forms a complex with YaeT, YfiO, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X7E4 at UniProt or InterPro

Protein Sequence (405 amino acids)

>Xcc-8004.2733.1 Outer membrane protein YfgL, lipoprotein component of the protein assembly complex (forms a complex with YaeT, YfiO, and NlpB) (Xanthomonas campestris pv. campestris strain 8004)
MKQVDMYKRVALIALMGMSLAGCSTVKGWFAGKDAAAKKAQEPAELVKFEPSVKVDKLWS
TGVGKGEGHIGVRQRPAVADGKVYAAAITGGVQALDLQTGKRVWEYKPKKEERNDRKFKQ
RLSGGPGVGEGLVVIGTLSGDVIALNQADGTEKWRAKVPNEVIAAPAIAQSLVLVRSNDG
RVSAFDAATGERRWFHAEEGPTLSVRGNAPIVTGPGVVFVGNDVGTLSALALQDGRPLWE
QAIGVPEGRTELERMSDVDGAPVLDGTTLYATSFKNETLALEGPSGRPLWTRDHGGAGGP
GVSSSVVVVADNAGSVWGLDKSSGAAMWSQAALARRSLTGVAIQGDYAVVGDYKGYLHWL
KLSDGALAARARAGRDTLLAQPLVVDGILLVQNTDGDITAFRLAQ