Protein Info for Xcc-8004.2722.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Putative outer membrane or secreted lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF06884: DUF1264" amino acids 49 to 217 (169 residues), 210.2 bits, see alignment E=8.5e-67

Best Hits

Swiss-Prot: 35% identical to OBP1A_MAIZE: Oil body-associated protein 1A (OBAP1A) from Zea mays

KEGG orthology group: None (inferred from 99% identity to xca:xccb100_2297)

Predicted SEED Role

"Putative outer membrane or secreted lipoprotein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X7D4 at UniProt or InterPro

Protein Sequence (251 amino acids)

>Xcc-8004.2722.1 Putative outer membrane or secreted lipoprotein (Xanthomonas campestris pv. campestris strain 8004)
MRPSLLLLPLAFCAACSRIPPPVTPPGAEETTKTNVLEAGAKVLQSNGPVGKLDIYLVGF
HPMKDAPEQQMEAHHYCQQVNQDLAQCALYDGNTAEANLTGIEYIISESLFAQLPAQERA
FWHPHNGEILSGQLSAPNLPLVAEKELMRSKMNSYGKTWHTWHSRKGTAPGDTLPLGEPM
LAWSFSRDGEIQQPLIEQRDKAVTISTAERRADRKDLTELAKPQHGVDALHRHFPEATPI
PGVVDAEATAQ