Protein Info for Xcc-8004.2630.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Adsorption protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 325 to 347 (23 residues), see Phobius details

Best Hits

Swiss-Prot: 93% identical to G3P_BPPHL: Attachment protein G3P (III) from Xanthomonas phage phiLf

KEGG orthology group: None (inferred from 100% identity to xcb:XC_2112)

Predicted SEED Role

"Adsorption protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X758 at UniProt or InterPro

Protein Sequence (350 amino acids)

>Xcc-8004.2630.1 Adsorption protein (Xanthomonas campestris pv. campestris strain 8004)
VIRVSLAMLILLALTFSPIVHATCVQTEPSTSANNGSWACSDQGEAFAKASSMGVPADLS
VCRMKSIRAVSSGPGVFSQRMTYPGDTCGIGYDLDIGTGNATYPDTATCAKRPSQSGWTN
PTAPTPSDVCNDGCYYTYAVDAGGPKGYTYVPSGATCTTDDAAPPIDDGGDGDDDGGGDG
GGDGGGDGGGDGGGDGGGDGGGDGGGDGGGDGGGDGDGGGDGDGDGDGDGDGDGDGDGDG
GTLPGDGDGEEGGEGAPMSELYKKSGKTVESVLSKFNTQVRGTPMVAGIGDFMKVPSGGS
CPVFSLGASKWWDAMTINFHCGGDFLAFLRAAGWVILAIAAYAAIRIAVT