Protein Info for Xcc-8004.2617.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Zinc transporter ZupT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 40 to 58 (19 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 120 to 137 (18 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details amino acids 185 to 208 (24 residues), see Phobius details amino acids 215 to 237 (23 residues), see Phobius details amino acids 249 to 270 (22 residues), see Phobius details PF02535: Zip" amino acids 117 to 262 (146 residues), 78.6 bits, see alignment E=2.6e-26

Best Hits

Swiss-Prot: 100% identical to ZUPT_XANCP: Zinc transporter ZupT (zupT) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K07238, zinc transporter, ZIP family (inferred from 100% identity to xcb:XC_2100)

Predicted SEED Role

"Zinc transporter ZupT"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X748 at UniProt or InterPro

Protein Sequence (272 amino acids)

>Xcc-8004.2617.1 Zinc transporter ZupT (Xanthomonas campestris pv. campestris strain 8004)
MLEVSSHNVWTALAVTLAAGLATGLGSLMVVFAKKPNPRLLAFGLAFAGGAMVFVSLSEI
LNKSIASFSNAYNDKLGFTYGTLTFLGGMLLIMVIDRLVPNPHQSLSTDDPQFRDDNRAY
IRRVGLLTAVAITAHNFPEGLATFFATLESPAVGMPLAFAIAIHNIPEGIAIAVPVYFAT
RNKFYAFGASLLSGLAEPIGAGIGYLLLSSVLSEAVFGAVFGVIAGVMVFLALDELLPAA
KRYAQGHETVYGLVSGMGTLAISLVLFRYAAP