Protein Info for Xcc-8004.2409.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: tRNA-specific adenosine-34 deaminase (EC 3.5.4.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00383: dCMP_cyt_deam_1
  • amino acids 16 to 116 (101 residues), 104.8 bits, E=2.1e-34
• PF14437: MafB19-deam
  • amino acids 17 to 144 (128 residues), 100 bits, E=1e-32

Best Hits

Swiss-Prot: 58% identical to TADA_SHIFL: tRNA-specific adenosine deaminase (tadA) from Shigella flexneri

KEGG orthology group: None (inferred from 99% identity to xcb:XC_1949)

MetaCyc: 58% identical to tRNA adenosine34 deaminase (Escherichia coli K-12 substr. MG1655)
3.5.4.-

Predicted SEED Role

"tRNA-specific adenosine-34 deaminase (EC 3.5.4.-)" in subsystem tRNA processing (EC 3.5.4.-)

KEGG Metabolic Maps

• Atrazine degradation

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.-

Use Curated BLAST to search for 3.5.4.-

Sequence Analysis Tools

See A0A0H2X716 at UniProt or InterPro

Protein Sequence (171 amino acids)

>Xcc-8004.2409.1 tRNA-specific adenosine-34 deaminase (EC 3.5.4.-) (Xanthomonas campestris pv. campestris strain 8004)
VSVSPDHHAQDAHLQIDQQWMTHALRLAERAERDYDEIPVGAVLVDPTGALLGEGWNFNI
ASHDPSAHAEIMAMREGGRRLANHRLIGCTLYVTLEPCAMCAMAMIHARIARVVFAASDP
KTGACGSVFDLLADPRHNHRVQVSGGVLAAEAGLRLTNYFRAKRGKPPLVP