Protein Info for Xcc-8004.2369.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Sugar ABC transporter, sugar permease protein 2 USSDB1D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 78 to 99 (22 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details amino acids 139 to 163 (25 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 94 to 269 (176 residues), 77.4 bits, see alignment E=6e-26

Best Hits

Swiss-Prot: 32% identical to Y1216_PYRHO: Probable ABC transporter permease protein PH1216 (PH1216) from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

KEGG orthology group: K10190, lactose/L-arabinose transport system permease protein (inferred from 100% identity to xca:xccb100_1976)

Predicted SEED Role

"Sugar ABC transporter, sugar permease protein 2 USSDB1D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X6Z0 at UniProt or InterPro

Protein Sequence (278 amino acids)

>Xcc-8004.2369.1 Sugar ABC transporter, sugar permease protein 2 USSDB1D (Xanthomonas campestris pv. campestris strain 8004)
MSRDVGESRWNGLLINGGLLLLALVSLAPLLWMLSVSFMPTGEASRFPPPMLPSAFTLAN
YHELFARTGMARNFANSLMVSGLITLGSLLINTMAGYAFAKLQFIGRERIFKILMAALVI
PAQVAMLPLFLLMKQLHLVNNIGGVVVPALATVFGIFLVRQYARSIPDELIEAARIDGAS
EMRIFFQIVLPMLKPVLVTLTIFTFMGSWNDFMWPLIVLTDQEQYTLPVALAALSREHIM
DVELMMAGAVVTVIPVLLLFLALQRYYIQGLLLGSVKG