Protein Info for Xcc-8004.2341.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Cytochrome c-type biogenesis protein CcmG/DsbE, thiol:disulfide oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details TIGR00385: periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily" amino acids 20 to 183 (164 residues), 171.4 bits, see alignment E=6.9e-55 PF00578: AhpC-TSA" amino acids 48 to 164 (117 residues), 52 bits, see alignment E=6.9e-18 PF08534: Redoxin" amino acids 49 to 173 (125 residues), 61.7 bits, see alignment E=7.3e-21

Best Hits

Swiss-Prot: 44% identical to DSBE_ALLVD: Thiol:disulfide interchange protein DsbE (dsbE) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: K02199, cytochrome c biogenesis protein CcmG, thiol:disulfide interchange protein DsbE (inferred from 100% identity to xcb:XC_1892)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmG/DsbE, thiol:disulfide oxidoreductase" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X6X5 at UniProt or InterPro

Protein Sequence (200 amino acids)

>Xcc-8004.2341.1 Cytochrome c-type biogenesis protein CcmG/DsbE, thiol:disulfide oxidoreductase (Xanthomonas campestris pv. campestris strain 8004)
MSDPRTSRLPTAVLVGAGILLLALAALLVYAVVRSGNDDRDALPSALIGKPAPEFALPLL
HDPSIIVHARELRGAPYIINVWGSWCPACREEHPVLSRFALTKRVRVIGYNWKDERADAL
RWLEQLGNPYLLVVADTDGRTAIDFGIAAAPETFLVDGRGVVRWKYSGMLTQSIIDTQLI
PALTRIERSPSAAPDLHTAR