Protein Info for Xcc-8004.2339.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Cytochrome c heme lyase subunit CcmH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 27 to 49 (23 residues), see Phobius details PF14559: TPR_19" amino acids 68 to 123 (56 residues), 28.6 bits, see alignment E=4.3e-10 PF13432: TPR_16" amino acids 69 to 120 (52 residues), 33 bits, see alignment 2.2e-11 amino acids 142 to 177 (36 residues), 18.8 bits, see alignment 5.8e-07 PF07719: TPR_2" amino acids 86 to 118 (33 residues), 23.7 bits, see alignment 1.1e-08 PF13428: TPR_14" amino acids 88 to 128 (41 residues), 24.3 bits, see alignment 1.1e-08

Best Hits

KEGG orthology group: K02200, cytochrome c-type biogenesis protein CcmH (inferred from 100% identity to xcb:XC_1890)

Predicted SEED Role

"Cytochrome c heme lyase subunit CcmH" in subsystem Biogenesis of c-type cytochromes or Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X8K0 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Xcc-8004.2339.1 Cytochrome c heme lyase subunit CcmH (Xanthomonas campestris pv. campestris strain 8004)
MAIFVACIVVLAVLAFGLVLRPLWREARGLAGALVVLLLAASAALYWLVGTPAAIEQTAD
RPAKPRTLDEAIVQLRTALARNPDQAEGWVLLGRSLSSQEKFAEARDAFARAVALRPDEP
DVLVAAAQTRMLADDTPQPDHEAQRLLEHALAVQPEHERARWFLGVVQRQAGQPAAASAT
WLPLLEVVDPKTRPGLLEQINAARREAKLEPIQAAAPATATASTGKAIRVRVVLDAEFAK
RAGLPADTSVFVIARSADTPMPVAVEKHPLSALPLTVTLDDGDSPMPTRTLSSLDKVQLV
ARLSRSGNAMRQSDDVESTPVTVQLPTDAQLELVIGR