Protein Info for Xcc-8004.2334.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Transport ATP-binding protein CydD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 607 transmembrane" amino acids 71 to 94 (24 residues), see Phobius details amino acids 114 to 124 (11 residues), see Phobius details amino acids 194 to 227 (34 residues), see Phobius details amino acids 290 to 314 (25 residues), see Phobius details amino acids 325 to 345 (21 residues), see Phobius details TIGR02857: thiol reductant ABC exporter, CydD subunit" amino acids 69 to 597 (529 residues), 503.8 bits, see alignment E=3.7e-155 PF00664: ABC_membrane" amino acids 72 to 317 (246 residues), 70.6 bits, see alignment E=2.8e-23 PF00005: ABC_tran" amino acids 418 to 555 (138 residues), 89 bits, see alignment E=6.6e-29 PF13304: AAA_21" amino acids 535 to 588 (54 residues), 31.7 bits, see alignment 2.6e-11

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 99% identity to xca:xccb100_1949)

Predicted SEED Role

"Transport ATP-binding protein CydD" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X6W9 at UniProt or InterPro

Protein Sequence (607 amino acids)

>Xcc-8004.2334.1 Transport ATP-binding protein CydD (Xanthomonas campestris pv. campestris strain 8004)
LIQIKAATDGCVRLSNPQPWDGDLQLRSAAMSSESDVSQPSVPASETPAQRRQRGQWLDA
LAAPATRARRLAGVAVTISGVLLLLQSAAIAWLIQSVLVQHRPLAELGHVGLGLLGAAIG
RALCGAWAQSLAGEVADVAKHALRLRIARRLLEHGPVWLRRQRSGELGELSLAHSDALEG
YFVGYQLARTEMLVVPGLILLAVFSVDWVVGLVLLLTAPLIPFFMMLVGWGAEAAGREQL
GELARMGGHFADRLKGLGLLRVYGRGEAELGGIAAAADGVRERSLKVLRIAFLSSTVLEF
FASVSVAIVALYFGLSYLGMLDLHGLPSLGTGMFCLLLAPEFFAPLRRLAAHYHDRANAL
AAVSEAERLLHGFAPPAVAVQVPAVPARPLEPAQAHAPLLQARGLAVRPPGSPVQVVRDF
SLALEAGQRVALVGPSGSGKSTLLEGLAGWLELEGGSLAVRPGVRIGYAPQRPYLFHGSI
ADNLRLADPQANEARLRAVADAAQVLRFVTHLPDGLDTVIGERGFGLSGGEARRVALARL
LLREPDVLLLDEPTAFLDPDTEADLLRSLALFARGRAVVLATHSAAVMQWADTVIDLRGA
RVAMEQP