Protein Info for Xcc-8004.2238.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 573 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details PF12729: 4HB_MCP_1" amino acids 25 to 204 (180 residues), 92.5 bits, see alignment E=3.7e-30 PF00672: HAMP" amino acids 232 to 283 (52 residues), 42.5 bits, see alignment 9.8e-15 PF00015: MCPsignal" amino acids 342 to 488 (147 residues), 119.3 bits, see alignment E=2.5e-38

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to xca:xccb100_1857)

Predicted SEED Role

"chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X8B0 at UniProt or InterPro

Protein Sequence (573 amino acids)

>Xcc-8004.2238.1 chemotaxis protein (Xanthomonas campestris pv. campestris strain 8004)
MVSASACRRTALMHVHSRDIPMLGNLKIGTRLIVAFLIVSAIGACIGWVGYSNSGRLNDL
STTLYERELLGLSNVKEANINLIYAGRARANLLLASSAEERQSHVQNIDKYTAKVVDYMT
RARASFETDEGKTKLAQFDRAWQKYLDERGRFIEAANREALREANPELAELSRAVRASSD
EVDTLMTDLSSLRERSAASANAETGAIHSSSSKLLMAIICGGVLLGGVLGVVISRSVTGP
IRRAVEVANGLSEGDLTMRIEVHGRDEAAQLLEAMRTMVQKLSQVVGEVNTSAETLASAS
EEVSATAQSISQAASEQAAGVEETSASLEQMTASISQNTENARITDGMATQAAKETIEGG
EAVVATTQAMKQIAQKIGIIDDIAYQTNLLALNAAIEAARAGEHGKGFAVVAAEVRKLAE
RSQVAAQEIGEVASSSVELADRAGRLLDTIVPSIKRTSDLVQEISAASEEQSSGVSQINS
AVVQLSQTTQQNASASEELAATAEEMSAQAEQLQQSMAFFRLGGQAPASTPPKRGKAVAA
RATRSSGARTWRGTAAPAYAMSEGPDEGQFARF