Protein Info for Xcc-8004.207.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01832: 2-deoxy-D-gluconate 3-dehydrogenase
  • amino acids 5 to 251 (247 residues), 413.8 bits, E=1.2e-128
• PF00106: adh_short
  • amino acids 10 to 201 (192 residues), 182.5 bits, E=1e-57
• PF08659: KR
  • amino acids 12 to 184 (173 residues), 30.5 bits, E=4.9e-11
• PF13561: adh_short_C2
  • amino acids 16 to 248 (233 residues), 190.6 bits, E=5.1e-60

Best Hits

Swiss-Prot: 69% identical to KDUD_ECOLI: 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase (kduD) from Escherichia coli (strain K12)

KEGG orthology group: K00065, 2-deoxy-D-gluconate 3-dehydrogenase [EC: 1.1.1.125] (inferred from 100% identity to xcb:XC_0161)

MetaCyc: 69% identical to putative 2-keto-3-deoxy-D-gluconate dehydrogenase (Escherichia coli K-12 substr. MG1655)
2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase. [EC: 1.1.1.127]; 1.1.1.- [EC: 1.1.1.127]; RXN0-7101 [EC: 1.1.1.127]

Predicted SEED Role

No annotation

MetaCyc Pathways

• 4-deoxy-L-threo-hex-4-enopyranuronate degradation (4/5 steps found)
• 2-deoxy-D-glucose 6-phosphate degradation (2/4 steps found)
• 3,6-anhydro-α-L-galactopyranose degradation (4/7 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (15/31 steps found)

KEGG Metabolic Maps

• Pentose and glucuronate interconversions

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.125 or 1.1.1.127

Sequence Analysis Tools

See A0A0H2X2H0 at UniProt or InterPro

Protein Sequence (251 amino acids)

>Xcc-8004.207.1 hypothetical protein (Xanthomonas campestris pv. campestris strain 8004)
MSNPFSLEGKVALVTGANTGLGQGIALALAEAGADIAAAGIQAPTETEEKVKAMGRRFVA
IEANLISIEPVQRILDETLAGLGRLDILVNNAGLIRRTDAVDFSEQDWDDVMNVNLKSAF
FMSQAAGRHFITQGSGKIINIASMLSFQGGIRVPSYTASKSGIAGITRLLANEWGSKGVT
ANAIAPGYMATDNTAQLRADQDRNKSILDRIPAARWGVPADLGGAAVFLASSASDYVNGA
IIPVDGGWLAR