Protein Info for Xcc-8004.1969.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Phosphoglucosamine mutase (EC 5.4.2.10)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 4 to 136 (133 residues), 151.3 bits, E=2.8e-48
• TIGR01455: phosphoglucosamine mutase
  • amino acids 7 to 446 (440 residues), 637 bits, E=7.1e-196
• PF02879: PGM_PMM_II
  • amino acids 159 to 256 (98 residues), 63.3 bits, E=5.4e-21
• PF02880: PGM_PMM_III
  • amino acids 260 to 367 (108 residues), 108.4 bits, E=4.8e-35
• PF00408: PGM_PMM_IV
  • amino acids 376 to 445 (70 residues), 47.1 bits, E=4e-16

Best Hits

Swiss-Prot: 100% identical to GLMM_XANCP: Phosphoglucosamine mutase (glmM) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K03431, phosphoglucosamine mutase [EC: 5.4.2.10] (inferred from 100% identity to xca:xccb100_1623)

MetaCyc: 56% identical to phosphoglucosamine mutase (Escherichia coli K-12 substr. MG1655)
Phosphoglucosamine mutase. [EC: 5.4.2.10]

Predicted SEED Role

"Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 5.4.2.10)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (11/11 steps found)
• superpathway of anaerobic sucrose degradation (16/19 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis I (5/5 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• sucrose degradation IV (sucrose phosphorylase) (4/4 steps found)
• colanic acid building blocks biosynthesis (9/11 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• glucose and glucose-1-phosphate degradation (4/5 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (3/4 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• chitin biosynthesis (6/9 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• glucosylglycerol biosynthesis (3/5 steps found)
• sucrose biosynthesis II (5/8 steps found)
• starch degradation III (2/4 steps found)
• starch degradation V (2/4 steps found)
• peptidoglycan recycling I (9/14 steps found)
• glycogen degradation II (3/6 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (2/5 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (4/8 steps found)
• glycogen degradation I (4/8 steps found)
• starch biosynthesis (5/10 steps found)
• CMP-legionaminate biosynthesis I (2/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (8/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• streptomycin biosynthesis (2/18 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (6/24 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.10

Sequence Analysis Tools

See Q4UWC8 at UniProt or InterPro

Protein Sequence (449 amino acids)

>Xcc-8004.1969.1 Phosphoglucosamine mutase (EC 5.4.2.10) (Xanthomonas campestris pv. campestris strain 8004)
MSSRKYFGTDGIRGRVGQGVISADFVLRLGNALGRVLTAGRSKRPLVLIGKDTRISGYMF
EAALEAGLVAAGADVQLIGPMPTPAIAFLTSTLRADAGVVISASHNPHYDNGIKFFSAEG
EKLDDATEAAIEAALDAPFHTVESERLGKAIRTRDAIGRYIEFCKASVPRGFTLHGLKMV
LDCAHGATYHIAPMLFRELGAEVVVIGAAPDGLNINDGVGSTHIDNLAAKVRETGAQLGI
AFDGDGDRVLMADDQGNPVDGDDLLYVLARSWQASGRLTGTVVGTLMTNYGLEKALAALQ
IPFQRAKVGDRYVHQALVEGGGTLGGETSGHLLCLDRATTGDGIVSALQVLEALGRDGHS
LREALSSLSKVPQQTVNVRLGGGAAKAIVEAASVQQALQQAQAAVQGRGRAFLRPSGTEP
VVRVTVEADEAGLMQDTLDRLAGAVRDAA