Protein Info for Xcc-8004.1894.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Proton/glutamate symport protein @ Sodium/glutamate symport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 44 to 67 (24 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 163 to 181 (19 residues), see Phobius details amino acids 203 to 227 (25 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details amino acids 270 to 291 (22 residues), see Phobius details amino acids 311 to 333 (23 residues), see Phobius details amino acids 345 to 362 (18 residues), see Phobius details amino acids 368 to 390 (23 residues), see Phobius details PF00375: SDF" amino acids 13 to 415 (403 residues), 359.7 bits, see alignment E=1e-111

Best Hits

KEGG orthology group: None (inferred from 100% identity to xcb:XC_1520)

Predicted SEED Role

"Proton/glutamate symport protein @ Sodium/glutamate symport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X7P5 at UniProt or InterPro

Protein Sequence (446 amino acids)

>Xcc-8004.1894.1 Proton/glutamate symport protein @ Sodium/glutamate symport protein (Xanthomonas campestris pv. campestris strain 8004)
MTLVSAWLRIPFWQRVVAGFVLGAIAGAAMGPAAEVWFGPLGDLYVTLIKMIAVPLVFFA
VINAISSLHGQKSVAALGGRTFLWFVITAALAVGVGLAVGTIMQPGAGHFSLSVDSAWKP
RDVPSPIKVLLDVVPSNPFYALTGIGTKTNAAGETVLAAGRGSILPVIFFAALLGFAMVK
LGDRVAEARKLTGQMSDIMIQVTRFVLEMTPLGTFGLIAGLVGSYGFAKLLPFGNFVLAL
YVACALHIVVVYSSLLLLHGLNPWKFFRGAAPGMQVAFVSSSSFAAMPVAMRSITHNLGV
NKDYAAFAVPLGASIKMDGCGAIFPALCAVFIAQYTGVPLTANQYFVVLIASVLGSFGTA
GVPGTAVVMATVVLSAANLPLEVIGYLYAIDRILDMMRTMTNVTGQMLVPVLVAKETGLL
DKTIYESASTNVGLEDPPTDRAAPLR