Protein Info for Xcc-8004.1883.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: TldD protein, part of TldE/TldD proteolytic complex

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 PF01523: PmbA_TldD_1st" amino acids 40 to 102 (63 residues), 62.3 bits, see alignment E=5.8e-21 PF19290: PmbA_TldD_2nd" amino acids 128 to 237 (110 residues), 90.8 bits, see alignment E=1.3e-29 PF19289: PmbA_TldD_3rd" amino acids 245 to 478 (234 residues), 234.1 bits, see alignment E=1.7e-73

Best Hits

Swiss-Prot: 63% identical to TLDD_ECOL6: Metalloprotease TldD (tldD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03568, TldD protein (inferred from 100% identity to xca:xccb100_1556)

MetaCyc: 63% identical to metalloprotease subunit TldD (Escherichia coli)
3.4.24.-

Predicted SEED Role

"TldD protein, part of TldE/TldD proteolytic complex"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0H2X7R1 at UniProt or InterPro

Protein Sequence (481 amino acids)

>Xcc-8004.1883.1 TldD protein, part of TldE/TldD proteolytic complex (Xanthomonas campestris pv. campestris strain 8004)
MTDTALTLAESRLLLPSGLDTGHLDRTFGALLGPGIDFGDLYFQHSRRESWSVEDGIVKD
GAHSIEQGVGVRAISGEKTGFAYSDDIQREALLEAAQSARAISRDGGAQSTRTLVRGNGR
ALYPATDPIDDMDSATKVDLLRRIDQYLRAADARVKQVMVNLSGGVDTVLIARSDGVLAA
DVRPLVRLNVQVIVEHGGRRESGYSGGGGRYGYAELFADGRPEGFAREALRQALVNLDAI
PAPAGVMPVVLGPGWPGVLLHEAVGHGLEGDFNRKGTSVYAGRIGERVASKGVTIVDDGT
LDGRRGSLNIDDEGTPSQCTTLIEDGVLVGYMQDTHNARLMGVAPTGNGRRESFAHLTMP
RMTNTYMRAGEHDPQEMIRSVKKGIYAVNFGGGQVDITSGKYVFSATEAYLIEDGKVTAP
VKGATLIGNGPETMQKVRMIGNDLALDEGVGVCGKDGQSVPVGVGQPSLLIDGITVGGTR
A