Protein Info for Xcc-8004.1768.1 in Xanthomonas campestris pv. campestris strain 8004

Annotation: Chemotaxis response regulator protein-glutamate methylesterase CheB (EC 3.1.1.61)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 369 PF00072: Response_reg" amino acids 18 to 119 (102 residues), 76.9 bits, see alignment E=1.4e-25 PF01339: CheB_methylest" amino acids 186 to 364 (179 residues), 222.3 bits, see alignment E=3.6e-70

Best Hits

Swiss-Prot: 100% identical to CHEB1_XANC8: Protein-glutamate methylesterase/protein-glutamine glutaminase 1 (cheB1) from Xanthomonas campestris pv. campestris (strain 8004)

KEGG orthology group: K03412, two-component system, chemotaxis family, response regulator CheB [EC: 3.1.1.61] (inferred from 100% identity to xcc:XCC2705)

MetaCyc: 47% identical to protein-glutamate methylesterase/protein glutamine deamidase (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Chemotaxis response regulator protein-glutamate methylesterase CheB (EC 3.1.1.61)" in subsystem Bacterial Chemotaxis (EC 3.1.1.61)

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.61

Use Curated BLAST to search for 3.1.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4UWU6 at UniProt or InterPro

Protein Sequence (369 amino acids)

>Xcc-8004.1768.1 Chemotaxis response regulator protein-glutamate methylesterase CheB (EC 3.1.1.61) (Xanthomonas campestris pv. campestris strain 8004)
VSTAFNRPIPQSQTIKAMVVDDSAVVRQVLVGVLNEAPGIEVIATAADPLLAIEKMRQQW
PDVIVLDVEMPRMDGITFLRKIMSERPTPVVICSTLTEKGARVTMDALAAGAVAVVTKPR
LGLKQFLTDSADELVATVRSAARANVKRLAARVTAAPLEAEVKHTADVILPAQTGRALAQ
TTERIVAIGTSTGGTQALEEVLTALPRVCPGIVIVQHMPEKFTAAFAARLNGLCQIAVKE
AANNDRVMPGRALIAPGGKHLLLRRSGAQYFVEVLEGPPVNRHRPSVDVLFRSAARAAGS
NALGIIMTGMGDDGAAGLLEMRQAGARTIAQDEHTSIVFGMPKEAIKRGGADRILPLGAM
AREIVTQLQ